PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g006280.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 175aa    MW: 20316.2 Da    PI: 9.9449
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g006280.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like932.4e-292982255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH+ F++ v++LGG +kAtPk+i+++m +kgL ++hvkSHLQ+YR 
  Sopim12g006280.0.1 29 PRLRWTPQLHHLFIQSVQNLGGRNKATPKRIVQMMAIKGLKISHVKSHLQMYRN 82
                        9****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-252884IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-222982IPR006447Myb domain, plants
SuperFamilySSF466892.15E-132984IPR009057Homeodomain-like
PfamPF002495.5E-73081IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEIFLMSQEM MRKSKKMKEV RKYKKSLAPR LRWTPQLHHL FIQSVQNLGG RNKATPKRIV  60
QMMAIKGLKI SHVKSHLQMY RNMREHPSLH VVMQDFNLSS PMHVSKILGE HAQNSRKQKE  120
SGSQNGENIH YNDFQEVEGS LSSGMTKEEE EDNDGEIYEY RETSTQINLD LTLS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-81HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251553.11e-127PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLK4DBG51e-127K4DBG5_SOLLC; Uncharacterized protein
STRINGSolyc12g006280.1.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.19e-25G2-like family protein